If you have been reading about SR9009 and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2025-10-12. Where a claim depends on a specific study, the study is described rather than over-claimed.
Research interest in SR9009 grew from studies showing improved running endurance in mice after short treatment periods. Those experiments linked the compound to increased mitochondrial content and fatty acid oxidation in muscle, but the findings come from animal models and specific dosing schedules. Independent replication has been limited, and the pathways connecting REV-ERB activation to exercise performance are still being mapped. Whether similar responses occur in humans is an open question.
SR9009 is often grouped with compounds studied for circadian and metabolic regulation rather than with classical anabolic steroids. Its interactions with nuclear receptors differ from those of androgen receptor ligands, and its proposed mechanisms involve transcriptional control rather than direct hormone signaling. Some sources classify it as a metabolic modulator because of observed effects on energy utilization. The distinction matters for regulation and for interpreting research results across different compound classes.
Scientific discussion of SR9009 often separates animal evidence from human anecdote. Rodent studies provide controlled data on endurance, metabolism, and gene expression, but they use specific strains, doses, and treatment durations. Human reports are mostly uncontrolled and cannot establish cause and effect. Open questions include oral bioavailability, tissue distribution, metabolic stability, and long-term effects. Review articles generally call for more rigorous pharmacokinetic and safety research before any clinical use could be considered.
Analytical methods for SR9009 typically rely on liquid chromatography coupled with tandem mass spectrometry. The technique can separate the parent compound from related substances and detect low concentrations in biological matrices. Urine and blood are common samples in anti-doping testing, while in vitro studies may use cell culture media. Rapid metabolism and low expected concentrations make method validation important for reliable identification. Exact metabolite patterns can vary by species and are not fully mapped.
Regulatory treatment of SR9009 reflects its investigational status. The compound has no approved human therapeutic indication, and sports authorities prohibit its use. It appears on anti-doping lists as a non-approved substance or metabolic modulator, depending on the list version. Products sold online as research chemicals are not quality-controlled medicines, so their identity and purity can differ from the label. Such products may also contain unlisted compounds, which complicates both testing and safety assessment.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C20H24ClN3O4S | Reported for the free base |
| Molecular weight | 437.9 g/mol | Calculated from the formula |
| Primary target | REV-ERBα and REV-ERBβ | Nuclear receptors involved in circadian regulation |
| Solubility | Soluble in DMSO and ethanol | Poorly soluble in water |
| Typical storage | -20 °C, desiccated | Protect from light and moisture |
SR9009 is frequently discussed in fitness and research-chemical contexts, yet it has no approved medical indication. Regulatory agencies have not authorized it for human use, and it is not a standard prescription drug. Some sports organizations list it as a prohibited substance because of its potential performance-enhancing properties. Published human data are sparse, so claims about its effects in people often rely on animal models or anecdotal reports. Quality and identity of online materials can vary widely.
SR9009 is a synthetic small molecule studied as a REV-ERB agonist. REV-ERBα and REV-ERBβ are nuclear receptors that help regulate circadian rhythms and metabolic gene expression. The compound was identified in academic screening efforts to find synthetic ligands for these receptors. In cell and animal studies, SR9009 alters transcription of genes involved in lipid and glucose metabolism, and it can shift circadian behavior. It is not an approved therapeutic agent.
Physicochemical behavior influences handling. SR9009 is described as a solid with limited aqueous solubility, so organic solvents such as dimethyl sulfoxide or ethanol are common in research stock solutions. Aqueous dilution can produce precipitates if the organic content is too low. Light, heat, and repeated freeze-thaw cycles may affect stability. Storage recommendations usually specify a desiccated freezer environment protected from light, but exact stability data depend on the formulation and matrix.
Detection in biological samples can be complicated by rapid metabolism and low circulating concentrations. Some studies report phase I and phase II metabolites, and analytical methods may need to target those species in addition to the parent compound. Immunoassays are not broadly available, so mass spectrometry remains the main confirmatory approach. For anti-doping testing, laboratories look for SR9009 and its metabolites using validated LC-MS methods. Open questions include how long metabolites remain detectable and how different routes of administration alter detection windows.
In laboratory settings, SR9009 is typically characterized by liquid chromatography–mass spectrometry (LC-MS) or high-performance liquid chromatography with ultraviolet detection (HPLC-UV). These methods can confirm identity and estimate purity, but they require reference standards for accurate quantification. Because SR9009 is not a licensed pharmaceutical, no harmonized pharmacopeial monograph exists. Laboratories often validate in-house methods for matrices such as plasma, urine, or cell culture media. Sample preparation may involve protein precipitation or liquid-liquid extraction before analysis.
== Commercial and clinical products == The clearest commercial example is the SERI Surgical Scaffold, a knitted mesh of highly purified silk fibroin that originated in research at Tufts University and was first marketed by Serica Technologies. The U.S. Food and Drug Administration cleared it in 2009 as a temporary scaffold for the support and reinforcement of soft tissue; the product was subsequently held by Allergan and then by Sofregen Medical. After implantation the mesh provides immediate mechanical support and is gradually resorbed and replaced by the patient's own collagen. Silk sutures remain in widespread clinical use, and other silk-based products and devices are in development or early clinical testing.
An aglycone (aglycon or genin) is the chemical compound remaining after the glycosyl group on a glycoside is replaced by a hydrogen atom. For example, the aglycone of a cardiac glycoside would be a steroid molecule.
== See also == 1973 European Cup final – contested by the same teams 1996 UEFA Cup Winners' Cup final 1996 UEFA Cup final 1995–96 AFC Ajax season 1995–96 Juventus FC season AFC Ajax in international football Juventus FC in international football
== Animal studies == Because of its significant role in the transportation of organic anion molecules and recent association with multiple illnesses including Alzheimer's disease (AD), the ABCC1 protein has become a potential drug target. In ABBC1 knockout mice, β-amyloid clearance is much lower than in wild-type mice that expressed the gene. Furthermore, in mouse models of AD, treatment with thiethylperazine, a drug that activates ABBC1, increases β-amyloid clearance and decreases in the amount of β-amyloid found in the brains. St. John's wort, a substance containing the chemical hyperforin, has also been shown to have a positive effect on activity levels of ABCC1. In a study of the effects of St. John's wort on APP-tg mice, an extract of St. John's wort that contained decreased levels of hyperforin increased the activity of ABCC1 by 70 percent and led to decreased amounts of β-amyloid in the brain and increased cognitive function in the mice.
SJS, like TEN and erythema multiforme, is characterized by confluent epidermal necrosis with minimal associated inflammation. The acuity is apparent from the (normal) basket weave-like pattern of the stratum corneum.
Sources: en.wikipedia.org
=== Venture capital === Verdine has worked in the venture capital industry as a Venture Partner with Apple Tree Partners, Third Rock Ventures, and WuXi Healthcare Ventures, and as a Special Advisor to Texas Pacific Group.
A notable and unusual building in the area is the so-called "Fetta di Polenta" (lit. 'polenta slice'), formerly known as Casa Scaccabarozzi. This building is where Corso San Maurizio meets Via Giulia di Barolo, and it is one of the most peculiar examples of Turin architecture: a thin trapezoid 27 m (89 ft) wide on Via Giulia Di Barolo, 5 m (16 ft) on Corso San Maurizio and just 0.70 m (2 ft 4 in) wide on the opposite end. It was designed in 1840 by Alessandro Antonelli for his wife, Francesca Scaccabarozzi. The curious name comes from the shape of the palace, which resembles a "slice of polenta", and also because it is painted with an ochre colour. In the surroundings, in Via Vanchiglia 8 (although in downtown and not really in Vanchiglia anymore), there is another trapezoid house, albeit with less extreme design: similarly, this building is nicknamed "Fetta di Formaggio" (lit. 'cheese slice'), built in 1832 for the rich Marchese Birago di Vische by the architect Antonio Talentino. Other notable buildings are the town public baths, eclectic building built in 1905 (Corso Regina Margherita crossing Via Vanchiglia), and theTeatro della Caduta theatre, opened in 2003 in Via Michele Buniva 23, which with its 45 seats is the smallest theatre in Turin and among the smallest theatres in Europe. In Corso Regina Margherita, another notable building is the former Opera pia Reynero, a charitable organisation. The building was built in 1892.
=== 27 December === Russian Foreign Minister Sergey Lavrov stated that Ukraine must accept Moscow's peace demands: "Our proposals for the demilitarisation and denazification of the territories controlled by the regime, the elimination of threats to Russia's security emanating from there, including our new lands, are well known to the enemy. The point is simple: Fulfil them for your own good. Otherwise, the issue will be decided by the Russian army." Russia banned crude oil sales to price cap nations which includes G7, European Union, and Australia. President Putin issued a decree that ban will be effective from 1 February 2023 up to 5 months and stated that sale ban could be lifted to individuals through "specific reasons".
Platelets in the blood have the ability to initiate the induction of EMT in cancer cells. When platelets are recruited to a site in the blood vessel they can release a variety of growth factors (PDGF, VEGF, Angiopoietin-1) and cytokines including the EMT inducer TGF-β. The release of TGF-β by platelets in blood vessels near primary tumors enhances invasiveness and promotes metastasis of cancer cells in the tumor. Studies looking at defective platelets and reduced platelet counts in mouse models have shown that impaired platelet function is associated with decreased metastatic formation. In humans, platelet counts and thrombocytosis within the upper end of the normal range have been associated with advanced, often metastatic, stage cancer in cervical cancer, ovarian cancer, gastric cancer, and esophageal cancer. Although a great deal of research has been applied to studying interactions between tumor cells and platelets, a cancer therapy targeting this interaction has not yet been established. This may be in part due to the redundancy of prothrombotic pathways which would require the use of multiple therapeutic approaches in order to prevent pro-metastatic events via EMT induction in cancer cells by activated platelets. To improve the chances for the development of a cancer metastasis, a cancer cell must avoid detection and targeting by the immune system once it enters the bloodstream.
The violence flared up again at a performance at the Electric Ballroom in Camden Town in September, with bottles thrown at the band while they played, and a section of the audience smashing up the amplification equipment and smashing the lights afterwards, with several people injured by flying glass. A major factor in the audience reaction was the length of the band's sets at the time, which lasted less than twenty-five minutes, Jim explaining this with "there's never been a group good enough to play any longer". Lack of songs was also a factor, according to Jim: "We've only got enough songs to play for that long". After the success of the album in the UK, the band embarked on a tour of the United States in late 1985 and 1986, followed by a tour of Japan. On returning to the UK they toured the UK, this time without the trouble that had marred earlier performances. The band revived their acoustic intentions with a stripped-down session for John Peel in November 1985, which included "Psychocandy", the original album title track that was omitted from the release, and "Some Candy Talking", a song which they had been performing for over a year, but had been left off the album. A second version of "Some Candy Talking" was issued on a free EP issued with the NME in January 1986, and the song was released as the band's next single in July.
Sources: en.wikipedia.org
Local fruits are quite common (including mangoes, papayas, and bananas) and fresh vegetables (including cassava and sweet potatoes). Mealtime is a communion for families and schools and some businesses close at midday for lunch, reopening later in the afternoon.
==== Thiolated chitosan ==== Thiolated chitosan is produced by attaching thiol groups to the amino groups of chitosan using a thiol-containing coupling agent. The primary site for this modification is the amino group at the 2nd position of chitosan's glucosamine units. During this process, thioglycolic acid and cysteine mediate the reaction, forming an amide bond between the thiol group and chitosan. At a pH below 5, thiol activity is reduced, which limits disulfide bond formation. The modified chitosan exhibits improved adhesive properties and stability due to the covalent attachment of the thiol groups. Lower pH reduces oxidation, enhancing its adhesion properties. Additionally, thiolated chitosan can interact with cell membrane receptors, improving membrane permeability and showing potential for applications in bacterial adhesion prevention, for example for coating stainless steel.
Nicotinamide adenine dinucleotide kinase 2, mitochondrial (NADK2), is a mitochondrial enzyme encoded by the human NADK2 gene. In eukaryotes it maintains the mitochondrial NADP(H) pool by phosphorylating NAD+ and NADH. NADPH plays a central role in mitochondrial metabolism by providing reducing power for protection against oxidative stress and for mitochondrial fatty acid synthesis (mtFAS), proline biosynthesis, lysine degradation, and the beta oxidation of polyunsaturated fatty acids. NADK2 was identified in humans by Ohashi et al. in 2012, more than a decade after its cytosolic counterpart, NADK1. Mutations in the NADK2 gene cause an autosomal recessive disorder known as NADK2 deficiency.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
Sources: en.wikipedia.org
It is a synthetic REV-ERB agonist used mainly in preclinical research. It is not an approved medicine for human use.
It binds to REV-ERBα and REV-ERBβ, nuclear receptors involved in circadian and metabolic gene regulation. This can alter transcription of genes related to lipid and glucose metabolism in experimental models.
No controlled human trials have established that effect. Endurance findings come primarily from rodent studies, and human responses remain unknown.
No. It is an investigational compound without approved therapeutic indications. It is sold for research purposes only in many jurisdictions.